SCOPe 2.08: Domain d5xyla1: 5xyl A:1-75

Lineage for d5xyla1 (5xyl A:1-75)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)

8. Domain d5xyla1: 5xyl A:1-75 [354814]
   Other proteins in same PDB: d5xyla2
   automated match to d5k35b1

Details for d5xyla1

PDB Entry: 5xyl

PDB Description: solution structure of skp1 from homo sapiens

PDB Compounds: (A:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d5xyla1:

Sequence; same for both SEQRES and ATOM records:

>d5xyla1 d.42.1.0 (A:1-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviq
wcthhkddppppedd

Timeline for d5xyla1:

• d5xyla1 first appeared in SCOPe 2.07