Lineage for d5ya0d_ (5ya0 D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531038Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2531039Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2531040Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 2531057Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)
  7. 2531084Species Escherichia coli [TaxId:562] [55599] (23 PDB entries)
  8. 3054749Domain d5ya0d_: 5ya0 D: [354811]
    automated match to d1poha_
    complexed with hez, po4

Details for d5ya0d_

PDB Entry: 5ya0 (more details), 3 Å

PDB Description: crystal structure of lsrk and hpr complex
PDB Compounds: (D:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d5ya0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ya0d_ d.94.1.1 (D:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

SCOPe Domain Coordinates for d5ya0d_:

Click to download the PDB-style file with coordinates for d5ya0d_.
(The format of our PDB-style files is described here.)

Timeline for d5ya0d_:

  • d5ya0d_ is new in SCOPe 2.07-stable