Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (81 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [354711] (4 PDB entries) |
Domain d5zw3a_: 5zw3 A: [354804] automated match to d5kvab_ complexed with mg, sah |
PDB Entry: 5zw3 (more details), 2.27 Å
SCOPe Domain Sequences for d5zw3a_:
Sequence, based on SEQRES records: (download)
>d5zw3a_ c.66.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]} tdryeqindyieallkprpdnvkrleayaeehhvpimekagmevllqilsvkqpkkilei gtaigysairmalelpsaeiytiernekrheeavnnikefqlddrihvfygdaleladav hvtapydvifidaakgqyqnffhlyepmlspdgviitdnvlfkglvaedyskiepkrrrr lvakideynhwlmnhpdyqtaiipvgdglaiskkkr
>d5zw3a_ c.66.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]} tdryeqindyieallkprpdnvkrleayaeehhvpimekagmevllqilsvkqpkkilei gtaigysairmalelpsaeiytiernekrheeavnnikefqlddrihvfygdaleladav hvtapydvifidaakgqyqnffhlyepmlspdgviitdnvlfkglvaedyskvakideyn hwlmnhpdyqtaiipvgdglaiskkkr
Timeline for d5zw3a_: