Lineage for d5zw3a_ (5zw3 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502203Species Bacillus subtilis [TaxId:224308] [354711] (4 PDB entries)
  8. 2502205Domain d5zw3a_: 5zw3 A: [354804]
    automated match to d5kvab_
    complexed with mg, sah

Details for d5zw3a_

PDB Entry: 5zw3 (more details), 2.27 Å

PDB Description: crystal structure of trmr from b. subtilis
PDB Compounds: (A:) Putative O-methyltransferase YrrM

SCOPe Domain Sequences for d5zw3a_:

Sequence, based on SEQRES records: (download)

>d5zw3a_ c.66.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
tdryeqindyieallkprpdnvkrleayaeehhvpimekagmevllqilsvkqpkkilei
gtaigysairmalelpsaeiytiernekrheeavnnikefqlddrihvfygdaleladav
hvtapydvifidaakgqyqnffhlyepmlspdgviitdnvlfkglvaedyskiepkrrrr
lvakideynhwlmnhpdyqtaiipvgdglaiskkkr

Sequence, based on observed residues (ATOM records): (download)

>d5zw3a_ c.66.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
tdryeqindyieallkprpdnvkrleayaeehhvpimekagmevllqilsvkqpkkilei
gtaigysairmalelpsaeiytiernekrheeavnnikefqlddrihvfygdaleladav
hvtapydvifidaakgqyqnffhlyepmlspdgviitdnvlfkglvaedyskvakideyn
hwlmnhpdyqtaiipvgdglaiskkkr

SCOPe Domain Coordinates for d5zw3a_:

Click to download the PDB-style file with coordinates for d5zw3a_.
(The format of our PDB-style files is described here.)

Timeline for d5zw3a_: