![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
![]() | Protein automated matches [226849] (8 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [272144] (6 PDB entries) |
![]() | Domain d6drvd5: 6drv D:732-1024 [354795] Other proteins in same PDB: d6drvd1, d6drvd2, d6drvd3, d6drvd4 automated match to d1jz8a4 |
PDB Entry: 6drv (more details), 2.2 Å
SCOPe Domain Sequences for d6drvd5:
Sequence; same for both SEQRES and ATOM records: (download)
>d6drvd5 b.30.5.0 (D:732-1024) automated matches {Escherichia coli [TaxId: 83333]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d6drvd5:
![]() Domains from same chain: (mouse over for more information) d6drvd1, d6drvd2, d6drvd3, d6drvd4 |