Lineage for d1noj__ (1noj -)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 494078Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 494079Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (8 families) (S)
  5. 494131Family c.87.1.4: Oligosaccharide phosphorylase [53766] (2 proteins)
  6. 494132Protein Glycogen phosphorylase [53767] (3 species)
    both domains are elaborated with many insertions
  7. 494152Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53769] (58 PDB entries)
  8. 494174Domain d1noj__: 1noj - [35479]

Details for d1noj__

PDB Entry: 1noj (more details), 2.4 Å

PDB Description: complex of glycogen phosphorylase with a transition state analogue nojirimycin tetrazole and phosphate in the t state

SCOP Domain Sequences for d1noj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1noj__ c.87.1.4 (-) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus)}
qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
fnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrf
ksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvkt
caytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslv
eegavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrw
lvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaayler
eykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkpap
gyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagt
easgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqey
ydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsaly
knprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdekip

SCOP Domain Coordinates for d1noj__:

Click to download the PDB-style file with coordinates for d1noj__.
(The format of our PDB-style files is described here.)

Timeline for d1noj__: