Lineage for d1noj__ (1noj -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27778Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
  4. 27779Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (4 families) (S)
  5. 27801Family c.87.1.4: Oligosaccharide phosphorylase [53766] (2 proteins)
  6. 27802Protein Glycogen phosphorylase [53767] (3 species)
  7. 27814Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53769] (44 PDB entries)
  8. 27824Domain d1noj__: 1noj - [35479]

Details for d1noj__

PDB Entry: 1noj (more details), 2.4 Å

PDB Description: complex of glycogen phosphorylase with a transition state analogue nojirimycin tetrazole and phosphate in the t state

SCOP Domain Sequences for d1noj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1noj__ c.87.1.4 (-) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus)}
qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
fnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrf
ksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvkt
caytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslv
eegavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrw
lvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaayler
eykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkpap
gyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagt
easgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqey
ydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsaly
knprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdekip

SCOP Domain Coordinates for d1noj__:

Click to download the PDB-style file with coordinates for d1noj__.
(The format of our PDB-style files is described here.)

Timeline for d1noj__: