Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (83 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [354746] (2 PDB entries) |
Domain d5xyja1: 5xyj A:3-274 [354789] automated match to d5byva1 complexed with gol |
PDB Entry: 5xyj (more details), 1.93 Å
SCOPe Domain Sequences for d5xyja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xyja1 c.95.1.0 (A:3-274) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} qnvyivstartpigsfqgslssktavelgavalkgalakvpeldaskdfdeiifgnvlsa nlgqaparqvalaaglsnhivastvnkvaasamkaiilgaqsikcgnadvvvaggcesmt napyympaaragakfgqtvlvdgverdglndaydglamgvhaekcardwditreqqdnfa iesyqksqksqkegkfdneivpvtikgfrgkpdtqvtkdeeparlhveklrsartvfqke ngtvtaanaspindgaaavilvsekvlkeknl
Timeline for d5xyja1: