Lineage for d5yica_ (5yic A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2410318Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2411713Protein automated matches [190156] (5 species)
    not a true protein
  7. 2411959Species Plasmodium falciparum [TaxId:36329] [354698] (5 PDB entries)
  8. 2411960Domain d5yica_: 5yic A: [354777]
    automated match to d1leea_
    complexed with 8vo, cps, gol

Details for d5yica_

PDB Entry: 5yic (more details), 1.9 Å

PDB Description: crystal structure of kni-10333 bound plasmepsin ii (pmii) from plasmodium falciparum
PDB Compounds: (A:) plasmepsin II

SCOPe Domain Sequences for d5yica_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yica_ b.50.1.2 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
sndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydss
ksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastfd
gilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyegp
ltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvpf
lpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfil
gdpfmrkyftvfdydnqsvgialakknl

SCOPe Domain Coordinates for d5yica_:

Click to download the PDB-style file with coordinates for d5yica_.
(The format of our PDB-style files is described here.)

Timeline for d5yica_: