Lineage for d5yoja_ (5yoj A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. Protein automated matches [190433] (12 species)
    not a true protein
  7. Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (32 PDB entries)
  8. Domain d5yoja_: 5yoj A: [354774]
    automated match to d3tl9b_
    complexed with 8z0, gol

Details for d5yoja_

PDB Entry: 5yoj (more details), 1.5 Å

PDB Description: structure of a17 hiv-1 protease in complex with inhibitor kni-1657
PDB Compounds: (A:) A17 HIV-1 protease

SCOPe Domain Sequences for d5yoja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yoja_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrpfvtikiggqlkealldtgaddtiieemslpgrwkpkivggiggfikvreyd
qiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf

SCOPe Domain Coordinates for d5yoja_ are not available.

Timeline for d5yoja_:

Domains from other chains:
(mouse over for more information)
d5yojb_