Class b: All beta proteins [48724] (180 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein automated matches [190433] (12 species) not a true protein |
Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (32 PDB entries) |
Domain d5yoja_: 5yoj A: [354774] automated match to d3tl9b_ complexed with 8z0, gol |
PDB Entry: 5yoj (more details), 1.5 Å
SCOPe Domain Sequences for d5yoja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yoja_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} pqitlwkrpfvtikiggqlkealldtgaddtiieemslpgrwkpkivggiggfikvreyd qiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf
Timeline for d5yoja_: