SCOPe 2.08: Domain d5yoja_: 5yoj A:

Lineage for d5yoja_ (5yoj A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (12 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (32 PDB entries)

8. Domain d5yoja_: 5yoj A: [354774]
   automated match to d3tl9b_
   complexed with 8z0, gol

Details for d5yoja_

PDB Entry: 5yoj, 1.5 Å

PDB Description: structure of a17 hiv-1 protease in complex with inhibitor kni-1657

PDB Compounds: (A:) A17 HIV-1 protease

SCOPe Domain Sequences for d5yoja_:

Sequence; same for both SEQRES and ATOM records:

>d5yoja_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrpfvtikiggqlkealldtgaddtiieemslpgrwkpkivggiggfikvreyd
qiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf

Timeline for d5yoja_:

• d5yoja_ first appeared in SCOPe 2.07