Lineage for d5xetc2 (5xet C:352-508)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319167Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2319168Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2319221Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 2319222Protein automated matches [226872] (13 species)
    not a true protein
  7. 2319252Species Mycobacterium tuberculosis [TaxId:419947] [354654] (2 PDB entries)
  8. 2319255Domain d5xetc2: 5xet C:352-508 [354767]
    Other proteins in same PDB: d5xetc1
    automated match to d2x1la2
    protein/RNA complex; complexed with edo, me8, mg

Details for d5xetc2

PDB Entry: 5xet (more details), 2.38 Å

PDB Description: crystal structure of mycobacterium tuberculosis methionyl-trna synthetase bound by methionyl-adenylate (met-amp)
PDB Compounds: (C:) Methionine--tRNA ligase

SCOPe Domain Sequences for d5xetc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xetc2 a.27.1.0 (C:352-508) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
anelgnlaqrslsmvaknldgrvpnpgefadadaallatadgllervrghfdaqamhlal
eaiwlmlgdankyfsvqqpwvlrkseseadqarfrttlyvtcevvriaalliqpvmpesa
gkildllgqapnqrsfaavgvrltpgtalppptgvfp

SCOPe Domain Coordinates for d5xetc2:

Click to download the PDB-style file with coordinates for d5xetc2.
(The format of our PDB-style files is described here.)

Timeline for d5xetc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5xetc1