Lineage for d5xetc1 (5xet C:2-351)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469303Species Mycobacterium tuberculosis [TaxId:419947] [354652] (2 PDB entries)
  8. 2469306Domain d5xetc1: 5xet C:2-351 [354766]
    Other proteins in same PDB: d5xetc2
    automated match to d2x1la1
    protein/RNA complex; complexed with edo, me8, mg

Details for d5xetc1

PDB Entry: 5xet (more details), 2.38 Å

PDB Description: crystal structure of mycobacterium tuberculosis methionyl-trna synthetase bound by methionyl-adenylate (met-amp)
PDB Compounds: (C:) Methionine--tRNA ligase

SCOPe Domain Sequences for d5xetc1:

Sequence, based on SEQRES records: (download)

>d5xetc1 c.26.1.0 (C:2-351) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
kpyyvttaiaypnaaphvghayeyiatdaiarfkrldrydvrfltgtdehglkvaqaaaa
agvptaalarrnsdvfqrmqealnisfdrfirttdadhheaskelwrrmsaagdiyldny
sgwysvrderffvesetqlvdgtrltvetgtpvtwteeqtyffrlsaytdkllahyhanp
dfiapetrrnevisfvsgglddlsisrtsfdwgvqvpehpdhvmyvwvdaltnyltgagf
pdtdselfrrywpadlhmigkdiirfhavywpaflmsagielprrifahgflhnrgekms
ksvgnivdpvalaealgvdqvryfllrevpfgqdgsysdeaivtrintdl

Sequence, based on observed residues (ATOM records): (download)

>d5xetc1 c.26.1.0 (C:2-351) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
kpyyvttaiaypnaaphvghayeyiatdaiarfkrldrydvrfltgtdehglkvaqaaaa
agvptaalarrnsdvfqrmqealnisfdrfirttdadhheaskelwrrmsaagdiyldny
sgwysvrderffvesetqlvdgtrltvetgtpvtwteeqtyffrlsaytdkllahyhanp
dfiapetrrnevisfvsgglddlsisrtsfdwgvqvpehpdhvmyvwvdaltnyltgagf
pdtdselfrrywpadlhmigkdiirfhavywpaflmsagielprrifahgflhnrkmsks
vgnivdpvalaealgvdqvryfllrevpfgqdgsysdeaivtrintdl

SCOPe Domain Coordinates for d5xetc1:

Click to download the PDB-style file with coordinates for d5xetc1.
(The format of our PDB-style files is described here.)

Timeline for d5xetc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5xetc2