Lineage for d5utzc1 (5utz C:1-111)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (29 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 3054702Domain d5utzc1: 5utz C:1-111 [354764]
    Other proteins in same PDB: d5utza_, d5utzc2, d5utzd_, d5utze_, d5utzi_
    automated match to d1lila1
    complexed with gol

Details for d5utzc1

PDB Entry: 5utz (more details), 2.75 Å

PDB Description: human il-2/fab complex
PDB Compounds: (C:) Fab 5111 light chain

SCOPe Domain Sequences for d5utzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5utzc1 b.1.1.0 (C:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqphsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnvvfgggtkltvlg

SCOPe Domain Coordinates for d5utzc1:

Click to download the PDB-style file with coordinates for d5utzc1.
(The format of our PDB-style files is described here.)

Timeline for d5utzc1:

  • d5utzc1 is new in SCOPe 2.07-stable