SCOPe 2.08: Domain d5y8mb2: 5y8m B:160-289

Lineage for d5y8mb2 (5y8m B:160-289)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [354674] (11 PDB entries)

8. Domain d5y8mb2: 5y8m B:160-289 [354763]
   Other proteins in same PDB: d5y8ma1, d5y8mb1
   automated match to d1yb4a2
   complexed with 9on, akr, gol, hiu, nad

Details for d5y8mb2

PDB Entry: 5y8m, 2.04 Å

PDB Description: mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + nad + (r)-3-hydroxyisobutyrate (r-hiba)

PDB Compounds: (B:) Probable 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d5y8mb2:

Sequence; same for both SEQRES and ATOM records:

>d5y8mb2 a.100.1.0 (B:160-289) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
aagagqaakvcnnmvlavqqiaiaeafvlaeklglsaqslfdvitgatgncwavhtncpv
pgpvptspanndfkpgfstalmnkdlglamdavaatgataplgshaadiyakfaadhadl
dfsavihtlr

Timeline for d5y8mb2:

• d5y8mb2 first appeared in SCOPe 2.07