Lineage for d1fa9a_ (1fa9 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74884Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
  4. 74885Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (5 families) (S)
  5. 74913Family c.87.1.4: Oligosaccharide phosphorylase [53766] (2 proteins)
  6. 74914Protein Glycogen phosphorylase [53767] (3 species)
  7. 74918Species Human (Homo sapiens) [TaxId:9606] [53768] (4 PDB entries)
  8. 74925Domain d1fa9a_: 1fa9 A: [35475]

Details for d1fa9a_

PDB Entry: 1fa9 (more details), 2.4 Å

PDB Description: human liver glycogen phosphorylase a complexed with amp

SCOP Domain Sequences for d1fa9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fa9a_ c.87.1.4 (A:) Glycogen phosphorylase {Human (Homo sapiens)}
tdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlv
grwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldieelee
ieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlr
ygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlw
sarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatl
qdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdieklpwska
weltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfpkdvdr
lrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkfqnktn
gitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkqenklk
fsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfvprtvi
iggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipatdlse
qistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddvaaldkk
gyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcq
dkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsn

SCOP Domain Coordinates for d1fa9a_:

Click to download the PDB-style file with coordinates for d1fa9a_.
(The format of our PDB-style files is described here.)

Timeline for d1fa9a_: