Class a: All alpha proteins [46456] (290 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) |
Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
Protein automated matches [226872] (13 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:419947] [354654] (2 PDB entries) |
Domain d5xgqa2: 5xgq A:352-513 [354743] Other proteins in same PDB: d5xgqa1, d5xgqa3, d5xgqb1, d5xgqb3 automated match to d2x1la2 |
PDB Entry: 5xgq (more details), 1.9 Å
SCOPe Domain Sequences for d5xgqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xgqa2 a.27.1.0 (A:352-513) automated matches {Mycobacterium tuberculosis [TaxId: 419947]} anelgnlaqrslsmvaknldgrvpnpgefadadaallatadgllervrghfdaqamhlal eaiwlmlgdankyfsvqqpwvlrkseseadqarfrttlyvtcevvriaalliqpvmpesa gkildllgqapnqrsfaavgvrltpgtalppptgvfpryqpp
Timeline for d5xgqa2: