SCOPe 2.08: Domain d5xgqa2: 5xgq A:352-513

Lineage for d5xgqa2 (5xgq A:352-513)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (13 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:419947] [354654] (2 PDB entries)

8. Domain d5xgqa2: 5xgq A:352-513 [354743]
   Other proteins in same PDB: d5xgqa1, d5xgqa3, d5xgqb1, d5xgqb3
   automated match to d2x1la2

Details for d5xgqa2

PDB Entry: 5xgq, 1.9 Å

PDB Description: crystal structure of apo form (free-state) mycobacterium tuberculosis methionyl-trna synthetase

PDB Compounds: (A:) Methionine-tRNA ligase

SCOPe Domain Sequences for d5xgqa2:

Sequence; same for both SEQRES and ATOM records:

>d5xgqa2 a.27.1.0 (A:352-513) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
anelgnlaqrslsmvaknldgrvpnpgefadadaallatadgllervrghfdaqamhlal
eaiwlmlgdankyfsvqqpwvlrkseseadqarfrttlyvtcevvriaalliqpvmpesa
gkildllgqapnqrsfaavgvrltpgtalppptgvfpryqpp

Timeline for d5xgqa2:

• d5xgqa2 first appeared in SCOPe 2.07