Lineage for d5ya2d_ (5ya2 D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)
  7. Species Escherichia coli [TaxId:562] [55599] (23 PDB entries)
  8. Domain d5ya2d_: 5ya2 D: [354733]
    automated match to d2jelp_
    complexed with adp, hez, po4

Details for d5ya2d_

PDB Entry: 5ya2 (more details), 2.7 Å

PDB Description: crystal structure of lsrk-hpr complex with adp
PDB Compounds: (D:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d5ya2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ya2d_ d.94.1.1 (D:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

SCOPe Domain Coordinates for d5ya2d_ are not available.

Timeline for d5ya2d_:

Domains from other chains:
(mouse over for more information)
d5ya2c_