Lineage for d5y8ja2 (5y8j A:160-291)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. Protein automated matches [226851] (46 species)
    not a true protein
  7. Species Mycobacterium tuberculosis [TaxId:83332] [354674] (11 PDB entries)
  8. Domain d5y8ja2: 5y8j A:160-291 [354723]
    Other proteins in same PDB: d5y8ja1, d5y8jb1, d5y8jb3
    automated match to d1yb4a2
    complexed with 9on, akr, gol, hiu

Details for d5y8ja2

PDB Entry: 5y8j (more details), 1.86 Å

PDB Description: mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (r)-3-hydroxyisobutyrate (r-hiba)
PDB Compounds: (A:) Probable 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d5y8ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y8ja2 a.100.1.0 (A:160-291) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
aagagqaakvcnnmvlavqqiaiaeafvlaeklglsaqslfdvitgatgncwavhtncpv
pgpvptspanndfkpgfstalmnkdlglamdavaatgataplgshaadiyakfaadhadl
dfsavihtlrar

SCOPe Domain Coordinates for d5y8ja2 are not available.

Timeline for d5y8ja2:

Domains from same chain:
(mouse over for more information)
d5y8ja1
Domains from other chains:
(mouse over for more information)
d5y8jb1, d5y8jb2, d5y8jb3