SCOPe 2.08: Domain d5y8ja1: 5y8j A:1-159

Lineage for d5y8ja1 (5y8j A:1-159)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [186789] (19 PDB entries)

8. Domain d5y8ja1: 5y8j A:1-159 [354722]
   Other proteins in same PDB: d5y8ja2, d5y8jb2, d5y8jb3
   automated match to d1yb4a1
   complexed with 9on, akr, gol, hiu

Details for d5y8ja1

PDB Entry: 5y8j, 1.86 Å

PDB Description: mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (r)-3-hydroxyisobutyrate (r-hiba)

PDB Compounds: (A:) Probable 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d5y8ja1:

Sequence; same for both SEQRES and ATOM records:

>d5y8ja1 c.2.1.0 (A:1-159) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mttiaflglgnmgapmsanlvgaghvvrgfdpaptaasgaaahgvavfrsapeavaeadv
vitmlptgevvrrcytdvlaaarpatlfidsstisvtdarevhalaeshgmlqldapvsg
gvkgaaaatlafmvggdestlrrarpvlepmagkiihcg

Timeline for d5y8ja1:

• d5y8ja1 first appeared in SCOPe 2.07