Lineage for d5yojb_ (5yoj B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2391027Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2392314Protein automated matches [190433] (12 species)
    not a true protein
  7. 2392358Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (30 PDB entries)
  8. 3054659Domain d5yojb_: 5yoj B: [354721]
    automated match to d3tl9b_
    complexed with 8z0, gol

Details for d5yojb_

PDB Entry: 5yoj (more details), 1.5 Å

PDB Description: structure of a17 hiv-1 protease in complex with inhibitor kni-1657
PDB Compounds: (B:) A17 HIV-1 protease

SCOPe Domain Sequences for d5yojb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yojb_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrpfvtikiggqlkealldtgaddtiieemslpgrwkpkivggiggfikvreyd
qiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf

SCOPe Domain Coordinates for d5yojb_:

Click to download the PDB-style file with coordinates for d5yojb_.
(The format of our PDB-style files is described here.)

Timeline for d5yojb_:

  • d5yojb_ is new in SCOPe 2.07-stable