Lineage for d1em6a_ (1em6 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27778Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
  4. 27779Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (4 families) (S)
  5. 27801Family c.87.1.4: Oligosaccharide phosphorylase [53766] (2 proteins)
  6. 27802Protein Glycogen phosphorylase [53767] (3 species)
  7. 27806Species Human (Homo sapiens) [TaxId:9606] [53768] (4 PDB entries)
  8. 27807Domain d1em6a_: 1em6 A: [35471]

Details for d1em6a_

PDB Entry: 1em6 (more details), 2.2 Å

PDB Description: human liver glycogen phosphorylase a complexed with glcnac and cp-526, 423

SCOP Domain Sequences for d1em6a_:

Sequence, based on SEQRES records: (download)

>d1em6a_ c.87.1.4 (A:) Glycogen phosphorylase {Human (Homo sapiens)}
envaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkr
vyylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaa
cfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvh
fygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfnlrdfnvgd
yiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgstrg
agtvfdafpdqvaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlp
ealerwpvdlvekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinm
ahlcivgshavngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglae
liaekigedyvkdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpss
mfdvqvkriheykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiik
litsvadvvnndpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkf
mlngaltigtmdganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklv
idqidngffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmv
lkniaasgkfssdrtikeyaqniwnveps

Sequence, based on observed residues (ATOM records): (download)

>d1em6a_ c.87.1.4 (A:) Glycogen phosphorylase {Human (Homo sapiens)}
envaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkr
vyylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaa
cfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvh
fygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapgdyiqavldrnl
aenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkastvfdafpdqvaiqlndt
hpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprhl
eiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakihs
divktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqltk
lhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqllnc
lhvitmynrikkdpfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkvi
flenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvemaeea
geenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiin
mlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqn
iwnveps

SCOP Domain Coordinates for d1em6a_:

Click to download the PDB-style file with coordinates for d1em6a_.
(The format of our PDB-style files is described here.)

Timeline for d1em6a_: