Lineage for d5ya2c_ (5ya2 C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531038Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2531039Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2531040Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 2531057Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)
  7. 2531084Species Escherichia coli [TaxId:562] [55599] (23 PDB entries)
  8. 3054638Domain d5ya2c_: 5ya2 C: [354700]
    automated match to d2jelp_
    complexed with adp, hez, po4

Details for d5ya2c_

PDB Entry: 5ya2 (more details), 2.7 Å

PDB Description: crystal structure of lsrk-hpr complex with adp
PDB Compounds: (C:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d5ya2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ya2c_ d.94.1.1 (C:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

SCOPe Domain Coordinates for d5ya2c_:

Click to download the PDB-style file with coordinates for d5ya2c_.
(The format of our PDB-style files is described here.)

Timeline for d5ya2c_:

  • d5ya2c_ is new in SCOPe 2.07-stable