Lineage for d1f6dd_ (1f6d D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2159528Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2159529Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2159564Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (2 proteins)
    automatically mapped to Pfam PF02350
  6. 2159565Protein UDP-N-acetylglucosamine 2-epimerase [53764] (3 species)
  7. 2159569Species Escherichia coli [TaxId:562] [53765] (2 PDB entries)
  8. 2159573Domain d1f6dd_: 1f6d D: [35470]
    complexed with cl, na, udp

Details for d1f6dd_

PDB Entry: 1f6d (more details), 2.5 Å

PDB Description: the structure of udp-n-acetylglucosamine 2-epimerase from e. coli.
PDB Compounds: (D:) udp-n-acetylglucosamine 2-epimerase

SCOPe Domain Sequences for d1f6dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6dd_ c.87.1.3 (D:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]}
mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl
rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv
rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq
ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl
gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq
acsrilealknnri

SCOPe Domain Coordinates for d1f6dd_:

Click to download the PDB-style file with coordinates for d1f6dd_.
(The format of our PDB-style files is described here.)

Timeline for d1f6dd_: