SCOPe 2.05: Domain d1f6dd_: 1f6d D:

Lineage for d1f6dd_ (1f6d D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (13 families)

5. Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (2 proteins)
   automatically mapped to Pfam PF02350

6. Protein UDP-N-acetylglucosamine 2-epimerase [53764] (3 species)

7. Species Escherichia coli [TaxId:562] [53765] (2 PDB entries)

8. Domain d1f6dd_: 1f6d D: [35470]
   complexed with cl, na, udp

Details for d1f6dd_

PDB Entry: 1f6d, 2.5 Å

PDB Description: the structure of udp-n-acetylglucosamine 2-epimerase from e. coli.

PDB Compounds: (D:) udp-n-acetylglucosamine 2-epimerase

SCOPe Domain Sequences for d1f6dd_:

Sequence; same for both SEQRES and ATOM records:

>d1f6dd_ c.87.1.3 (D:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]}
mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl
rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv
rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq
ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl
gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq
acsrilealknnri

Timeline for d1f6dd_:

• d1f6dd_ first appeared (with stable ids) in SCOP 1.55
  
• d1f6dd_ appears in SCOPe 2.04
  
• d1f6dd_ appears in SCOPe 2.06
  
• d1f6dd_ appears in the current release, SCOPe 2.08