Lineage for d5wdgb2 (5wdg B:188-366)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. Protein automated matches [190312] (14 species)
    not a true protein
  7. Species Klebsiella pneumoniae [TaxId:573] [319717] (3 PDB entries)
  8. Domain d5wdgb2: 5wdg B:188-366 [354695]
    Other proteins in same PDB: d5wdga1, d5wdga3, d5wdgb1, d5wdgb3, d5wdgb4
    automated match to d1ozha1
    complexed with a4y, mg, po4, pyr

Details for d5wdgb2

PDB Entry: 5wdg (more details), 2.12 Å

PDB Description: acetolactate synthase from klebsiella pneumoniae in complex with a reaction intermediate
PDB Compounds: (B:) Acetolactate synthase, catabolic

SCOPe Domain Sequences for d5wdgb2:

Sequence, based on SEQRES records: (download)

>d5wdgb2 c.31.1.0 (B:188-366) automated matches {Klebsiella pneumoniae [TaxId: 573]}
qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga
vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp
ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaql

Sequence, based on observed residues (ATOM records): (download)

>d5wdgb2 c.31.1.0 (B:188-366) automated matches {Klebsiella pneumoniae [TaxId: 573]}
qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga
vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp
ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrrgaql

SCOPe Domain Coordinates for d5wdgb2 are not available.

Timeline for d5wdgb2:

Domains from same chain:
(mouse over for more information)
d5wdgb1, d5wdgb3, d5wdgb4
Domains from other chains:
(mouse over for more information)
d5wdga1, d5wdga2, d5wdga3