SCOP 1.73: Domain d1f6da_: 1f6d A:

Lineage for d1f6da_ (1f6d A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (9 families)

5. Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (1 protein)

6. Protein UDP-N-acetylglucosamine 2-epimerase [53764] (3 species)

7. Species Escherichia coli [TaxId:562] [53765] (2 PDB entries)

8. Domain d1f6da_: 1f6d A: [35467]

Details for d1f6da_

PDB Entry: 1f6d, 2.5 Å

PDB Description: the structure of udp-n-acetylglucosamine 2-epimerase from e. coli.

PDB Compounds: (A:) udp-n-acetylglucosamine 2-epimerase

SCOP Domain Sequences for d1f6da_:

Sequence; same for both SEQRES and ATOM records:

>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]}
mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl
rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv
rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq
ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl
gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq
acsrilealknnrisl

Timeline for d1f6da_:

• d1f6da_ first appeared (with stable ids) in SCOP 1.55
  
• d1f6da_ appears in SCOP 1.71
  
• d1f6da_ appears in SCOP 1.75
  
• d1f6da_ appears in the current release, SCOPe 2.08