Lineage for d1f6da_ (1f6d A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 402819Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 402820Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (7 families) (S)
  5. 402851Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (1 protein)
  6. 402852Protein UDP-N-acetylglucosamine 2-epimerase [53764] (3 species)
  7. 402856Species Escherichia coli [TaxId:562] [53765] (2 PDB entries)
  8. 402857Domain d1f6da_: 1f6d A: [35467]

Details for d1f6da_

PDB Entry: 1f6d (more details), 2.5 Å

PDB Description: the structure of udp-n-acetylglucosamine 2-epimerase from e. coli.

SCOP Domain Sequences for d1f6da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli}
mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl
rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv
rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq
ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl
gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq
acsrilealknnrisl

SCOP Domain Coordinates for d1f6da_:

Click to download the PDB-style file with coordinates for d1f6da_.
(The format of our PDB-style files is described here.)

Timeline for d1f6da_: