![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (7 families) ![]() |
![]() | Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (1 protein) |
![]() | Protein UDP-N-acetylglucosamine 2-epimerase [53764] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [53765] (2 PDB entries) |
![]() | Domain d1f6da_: 1f6d A: [35467] |
PDB Entry: 1f6d (more details), 2.5 Å
SCOP Domain Sequences for d1f6da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli} mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq acsrilealknnrisl
Timeline for d1f6da_: