Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (54 PDB entries) |
Domain d6gfyk1: 6gfy K:17-112 [354666] Other proteins in same PDB: d6gfya_, d6gfyb2, d6gfyc_, d6gfyd_, d6gfye2, d6gfyf_, d6gfyg_, d6gfyh2, d6gfyi_, d6gfyj_, d6gfyk2, d6gfyl_ automated match to d1lm8c_ complexed with exh |
PDB Entry: 6gfy (more details), 2.7 Å
SCOPe Domain Sequences for d6gfyk1:
Sequence, based on SEQRES records: (download)
>d6gfyk1 d.42.1.1 (K:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d6gfyk1 d.42.1.1 (K:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvrytn ssteipefpiapeialellmaanfldc
Timeline for d6gfyk1: