Lineage for d6gfyk1 (6gfy K:17-112)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552337Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2552338Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2552339Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2552434Protein Elongin C [54699] (3 species)
  7. 2552437Species Human (Homo sapiens) [TaxId:9606] [54700] (54 PDB entries)
  8. 2552578Domain d6gfyk1: 6gfy K:17-112 [354666]
    Other proteins in same PDB: d6gfya_, d6gfyb2, d6gfyc_, d6gfyd_, d6gfye2, d6gfyf_, d6gfyg_, d6gfyh2, d6gfyi_, d6gfyj_, d6gfyk2, d6gfyl_
    automated match to d1lm8c_
    complexed with exh

Details for d6gfyk1

PDB Entry: 6gfy (more details), 2.7 Å

PDB Description: pvhl:elob:eloc in complex with modified vh032 containing (3r,4s)-3- fluoro-4-hydroxyproline (ligand 14a)
PDB Compounds: (K:) Elongin-C

SCOPe Domain Sequences for d6gfyk1:

Sequence, based on SEQRES records: (download)

>d6gfyk1 d.42.1.1 (K:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d6gfyk1 d.42.1.1 (K:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvrytn
ssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d6gfyk1:

Click to download the PDB-style file with coordinates for d6gfyk1.
(The format of our PDB-style files is described here.)

Timeline for d6gfyk1: