Lineage for d5xx9e_ (5xx9 E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2705135Species Streptomyces coelicolor [TaxId:100226] [354657] (1 PDB entry)
  8. 2705140Domain d5xx9e_: 5xx9 E: [354658]
    automated match to d3bkna_
    complexed with fe2

Details for d5xx9e_

PDB Entry: 5xx9 (more details), 2.6 Å

PDB Description: crystal structure of bacterioferritin
PDB Compounds: (E:) bacterioferritin

SCOPe Domain Sequences for d5xx9e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xx9e_ a.25.1.0 (E:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
mqgdpevieflneqltaeltainqyflhaklqdhkgwtklakytraesfdemrhaevltd
rillldglpnyqrlfhvrvgqsvtemfqadreveleaidrlrrgievmrakhditsanvf
eailadeehhidyletqldlieklgeslylstvieqtqpdp

SCOPe Domain Coordinates for d5xx9e_:

Click to download the PDB-style file with coordinates for d5xx9e_.
(The format of our PDB-style files is described here.)

Timeline for d5xx9e_: