Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [354657] (1 PDB entry) |
Domain d5xx9e_: 5xx9 E: [354658] automated match to d3bkna_ complexed with fe2 |
PDB Entry: 5xx9 (more details), 2.6 Å
SCOPe Domain Sequences for d5xx9e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xx9e_ a.25.1.0 (E:) automated matches {Streptomyces coelicolor [TaxId: 100226]} mqgdpevieflneqltaeltainqyflhaklqdhkgwtklakytraesfdemrhaevltd rillldglpnyqrlfhvrvgqsvtemfqadreveleaidrlrrgievmrakhditsanvf eailadeehhidyletqldlieklgeslylstvieqtqpdp
Timeline for d5xx9e_: