Lineage for d5xgqb2 (5xgq B:352-513)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705920Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2705921Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2705974Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 2705975Protein automated matches [226872] (13 species)
    not a true protein
  7. 2706005Species Mycobacterium tuberculosis [TaxId:419947] [354654] (2 PDB entries)
  8. 2706007Domain d5xgqb2: 5xgq B:352-513 [354655]
    Other proteins in same PDB: d5xgqa1, d5xgqa3, d5xgqb1, d5xgqb3
    automated match to d2x1la2

Details for d5xgqb2

PDB Entry: 5xgq (more details), 1.9 Å

PDB Description: crystal structure of apo form (free-state) mycobacterium tuberculosis methionyl-trna synthetase
PDB Compounds: (B:) Methionine-tRNA ligase

SCOPe Domain Sequences for d5xgqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xgqb2 a.27.1.0 (B:352-513) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
anelgnlaqrslsmvaknldgrvpnpgefadadaallatadgllervrghfdaqamhlal
eaiwlmlgdankyfsvqqpwvlrkseseadqarfrttlyvtcevvriaalliqpvmpesa
gkildllgqapnqrsfaavgvrltpgtalppptgvfpryqpp

SCOPe Domain Coordinates for d5xgqb2:

Click to download the PDB-style file with coordinates for d5xgqb2.
(The format of our PDB-style files is described here.)

Timeline for d5xgqb2: