Lineage for d5xgqb1 (5xgq B:1-351)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (60 species)
    not a true protein
  7. 2861039Species Mycobacterium tuberculosis [TaxId:419947] [354652] (2 PDB entries)
  8. 2861041Domain d5xgqb1: 5xgq B:1-351 [354653]
    Other proteins in same PDB: d5xgqa2, d5xgqa3, d5xgqb2, d5xgqb3
    automated match to d2x1la1

Details for d5xgqb1

PDB Entry: 5xgq (more details), 1.9 Å

PDB Description: crystal structure of apo form (free-state) mycobacterium tuberculosis methionyl-trna synthetase
PDB Compounds: (B:) Methionine-tRNA ligase

SCOPe Domain Sequences for d5xgqb1:

Sequence, based on SEQRES records: (download)

>d5xgqb1 c.26.1.0 (B:1-351) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
mkpyyvttaiaypnaaphvghayeyiatdaiarfkrldrydvrfltgtdehglkvaqaaa
aagvptaalarrnsdvfqrmqealnisfdrfirttdadhheaskelwrrmsaagdiyldn
ysgwysvrderffvesetqlvdgtrltvetgtpvtwteeqtyffrlsaytdkllahyhan
pdfiapetrrnevisfvsgglddlsisrtsfdwgvqvpehpdhvmyvwvdaltnyltgag
fpdtdselfrrywpadlhmigkdiirfhavywpaflmsagielprrifahgflhnrgekm
sksvgnivdpvalaealgvdqvryfllrevpfgqdgsysdeaivtrintdl

Sequence, based on observed residues (ATOM records): (download)

>d5xgqb1 c.26.1.0 (B:1-351) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
mkpyyvttaiaypnaaphvghayeyiatdaiarfkrldrydvrfltgtdgvptaalarrn
sdvfqrmqealnisfdrfirttdadhheaskelwrrmsaagdiyldnysgwysvrderff
vesetqlvdgtrltvetgtpvtwteeqtyffrlsaytdkllahyhanpdfiapetrrnev
isfvsgglddlsisrtsfdwgvqvpehpdhvmyvwvdaltnyltgagfpdtdselfrryw
padlhmigkdiirfhavywpaflmsagielprrifahgflhnrgivdpvalaealgvdqv
ryfllrevpfgqdgsysdeaivtrintdl

SCOPe Domain Coordinates for d5xgqb1:

Click to download the PDB-style file with coordinates for d5xgqb1.
(The format of our PDB-style files is described here.)

Timeline for d5xgqb1: