SCOPe 2.07: Domain d5w8za1: 5w8z A:1-61

Lineage for d5w8za1 (5w8z A:1-61)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (17 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:1218948] [354640] (1 PDB entry)

8. Domain d5w8za1: 5w8z A:1-61 [354641]
   Other proteins in same PDB: d5w8za2
   automated match to d2pijb_

Details for d5w8za1

PDB Entry: 5w8z

PDB Description: solution structure of xph2, a hybrid sequence of xfaso 1 and pfl 6, two cro proteins with different folds

PDB Compounds: (A:) xph2

SCOPe Domain Sequences for d5w8za1:

Sequence; same for both SEQRES and ATOM records:

>d5w8za1 a.35.1.0 (A:1-61) automated matches {Pseudomonas fluorescens [TaxId: 1218948]}
mkkiplskyleehgtqsalaaalgvnqsaisqmvragrcidielytdgrvecrelrpdvf
g

Timeline for d5w8za1:

• d5w8za1 is new in SCOPe 2.07-stable
  
• d5w8za1 appears in the current release, SCOPe 2.08