Lineage for d5wdga2 (5wdg A:188-366)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470834Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2470835Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2471274Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2471275Protein automated matches [190312] (14 species)
    not a true protein
  7. 2471331Species Klebsiella pneumoniae [TaxId:573] [319717] (3 PDB entries)
  8. 2471334Domain d5wdga2: 5wdg A:188-366 [354636]
    Other proteins in same PDB: d5wdga1, d5wdga3, d5wdgb1, d5wdgb3, d5wdgb4
    automated match to d1ozha1
    complexed with a4y, mg, po4, pyr

Details for d5wdga2

PDB Entry: 5wdg (more details), 2.12 Å

PDB Description: acetolactate synthase from klebsiella pneumoniae in complex with a reaction intermediate
PDB Compounds: (A:) Acetolactate synthase, catabolic

SCOPe Domain Sequences for d5wdga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wdga2 c.31.1.0 (A:188-366) automated matches {Klebsiella pneumoniae [TaxId: 573]}
qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga
vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp
ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaql

SCOPe Domain Coordinates for d5wdga2:

Click to download the PDB-style file with coordinates for d5wdga2.
(The format of our PDB-style files is described here.)

Timeline for d5wdga2: