Lineage for d5wdga1 (5wdg A:6-183)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. Protein automated matches [227126] (21 species)
    not a true protein
  7. Species Klebsiella pneumoniae [TaxId:573] [319715] (3 PDB entries)
  8. Domain d5wdga1: 5wdg A:6-183 [354635]
    Other proteins in same PDB: d5wdga2, d5wdgb2, d5wdgb4
    automated match to d1ozha2
    complexed with a4y, mg, po4, pyr

Details for d5wdga1

PDB Entry: 5wdg (more details), 2.12 Å

PDB Description: acetolactate synthase from klebsiella pneumoniae in complex with a reaction intermediate
PDB Compounds: (A:) Acetolactate synthase, catabolic

SCOPe Domain Sequences for d5wdga1:

Sequence, based on SEQRES records: (download)

>d5wdga1 c.36.1.0 (A:6-183) automated matches {Klebsiella pneumoniae [TaxId: 573]}
pvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafmaa
avgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhqsmdtv
amfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpa

Sequence, based on observed residues (ATOM records): (download)

>d5wdga1 c.36.1.0 (A:6-183) automated matches {Klebsiella pneumoniae [TaxId: 573]}
pvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafmaa
avgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkmdtvamfspvt
kyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpa

SCOPe Domain Coordinates for d5wdga1 are not available.

Timeline for d5wdga1:

Domains from same chain:
(mouse over for more information)
d5wdga2, d5wdga3
Domains from other chains:
(mouse over for more information)
d5wdgb1, d5wdgb2, d5wdgb3, d5wdgb4