SCOPe 2.08: Domain d6gooa_: 6goo A:

Lineage for d6gooa_ (6goo A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.0: automated matches [191441] (1 protein)
   not a true family

6. Protein automated matches [190651] (8 species)
   not a true protein

7. Species Gilthead seabream (Sparus aurata) [TaxId:8175] [354553] (7 PDB entries)

8. Domain d6gooa_: 6goo A: [354633]
   automated match to d1bzda_
   complexed with 8pf

Details for d6gooa_

PDB Entry: 6goo, 1.8 Å

PDB Description: crystal structure of sea bream transthyretin in complex with perfluorooctanoic acid (pfoa). crystallized in amso4

PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d6gooa_:

Sequence; same for both SEQRES and ATOM records:

>d6gooa_ b.3.4.0 (A:) automated matches {Gilthead seabream (Sparus aurata) [TaxId: 8175]}
cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvs

Timeline for d6gooa_:

• d6gooa_ first appeared in SCOPe 2.07