| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) ![]() |
| Family b.3.4.0: automated matches [191441] (1 protein) not a true family |
| Protein automated matches [190651] (8 species) not a true protein |
| Species Gilthead seabream (Sparus aurata) [TaxId:8175] [354553] (7 PDB entries) |
| Domain d6gnwd_: 6gnw D: [354628] automated match to d1bzda_ complexed with f52 |
PDB Entry: 6gnw (more details), 1.75 Å
SCOPe Domain Sequences for d6gnwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gnwd_ b.3.4.0 (D:) automated matches {Gilthead seabream (Sparus aurata) [TaxId: 8175]}
cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvss
Timeline for d6gnwd_: