Lineage for d6gnpa_ (6gnp A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378753Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2379529Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 2379530Protein automated matches [190651] (8 species)
    not a true protein
  7. 2379563Species Sparus aurata [TaxId:8175] [354553] (7 PDB entries)
  8. 2379578Domain d6gnpa_: 6gnp A: [354622]
    automated match to d1bzda_
    complexed with f4z

Details for d6gnpa_

PDB Entry: 6gnp (more details), 2.02 Å

PDB Description: crystal structure of sea bream transthyretin in complex with 3,5,6- trichloro-2-pyridinol (tc2p)
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d6gnpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gnpa_ b.3.4.0 (A:) automated matches {Sparus aurata [TaxId: 8175]}
cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvs

SCOPe Domain Coordinates for d6gnpa_:

Click to download the PDB-style file with coordinates for d6gnpa_.
(The format of our PDB-style files is described here.)

Timeline for d6gnpa_: