Lineage for d6ew5b1 (6ew5 B:0-131)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. Protein automated matches [190698] (25 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187833] (51 PDB entries)
  8. Domain d6ew5b1: 6ew5 B:0-131 [354614]
    Other proteins in same PDB: d6ew5a2, d6ew5b2, d6ew5c2, d6ew5d2
    automated match to d1vyfa_
    complexed with plm; mutant

Details for d6ew5b1

PDB Entry: 6ew5 (more details), 1.95 Å

PDB Description: human myelin protein p2 f57a mutant, monoclinic crystal form
PDB Compounds: (B:) myelin p2 protein

SCOPe Domain Sequences for d6ew5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ew5b1 b.60.1.0 (B:0-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msnkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdiitirtestakn
teisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeckm
kgvvctriyekv

SCOPe Domain Coordinates for d6ew5b1 are not available.

Timeline for d6ew5b1:

Domains from same chain:
(mouse over for more information)
d6ew5b2
Domains from other chains:
(mouse over for more information)
d6ew5a1, d6ew5a2, d6ew5c1, d6ew5c2, d6ew5d1, d6ew5d2