Lineage for d6gnwb_ (6gnw B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2365078Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2365764Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 2365765Protein automated matches [190651] (8 species)
    not a true protein
  7. 3054491Species Sparus aurata [TaxId:8175] [354553] (7 PDB entries)
  8. 3054548Domain d6gnwb_: 6gnw B: [354610]
    automated match to d1bzda_
    complexed with f52

Details for d6gnwb_

PDB Entry: 6gnw (more details), 1.75 Å

PDB Description: crystal structure of sea bream transthyretin in complex with 2,4,5- trichlorophenoxyacetic acid (2,4,5-t)
PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d6gnwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gnwb_ b.3.4.0 (B:) automated matches {Sparus aurata [TaxId: 8175]}
cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvssv

SCOPe Domain Coordinates for d6gnwb_:

Click to download the PDB-style file with coordinates for d6gnwb_.
(The format of our PDB-style files is described here.)

Timeline for d6gnwb_:

  • d6gnwb_ is new in SCOPe 2.07-stable