SCOPe 2.07: Domain d6gnra_: 6gnr A:

Lineage for d6gnra_ (6gnr A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.0: automated matches [191441] (1 protein)
   not a true family

6. Protein automated matches [190651] (8 species)
   not a true protein

7. Species Sparus aurata [TaxId:8175] [354553] (7 PDB entries)

8. Domain d6gnra_: 6gnr A: [354606]
   automated match to d1bzda_
   complexed with 6j3

Details for d6gnra_

PDB Entry: 6gnr, 1.4 Å

PDB Description: crystal structure of sea bream transthyretin in complex with 2-(3- chloro-2-methylanilino)pyridine-3-carboxylic acid (clonixin)

PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d6gnra_:

Sequence; same for both SEQRES and ATOM records:

>d6gnra_ b.3.4.0 (A:) automated matches {Sparus aurata [TaxId: 8175]}
cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvss

Timeline for d6gnra_:

• d6gnra_ is new in SCOPe 2.07-stable
  
• d6gnra_ appears in the current release, SCOPe 2.08