Lineage for d6gnrb_ (6gnr B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768957Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2769733Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 2769734Protein automated matches [190651] (8 species)
    not a true protein
  7. 2769759Species Gilthead seabream (Sparus aurata) [TaxId:8175] [354553] (7 PDB entries)
  8. 2769761Domain d6gnrb_: 6gnr B: [354596]
    automated match to d1bzda_
    complexed with 6j3

Details for d6gnrb_

PDB Entry: 6gnr (more details), 1.4 Å

PDB Description: crystal structure of sea bream transthyretin in complex with 2-(3- chloro-2-methylanilino)pyridine-3-carboxylic acid (clonixin)
PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d6gnrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gnrb_ b.3.4.0 (B:) automated matches {Gilthead seabream (Sparus aurata) [TaxId: 8175]}
cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvs

SCOPe Domain Coordinates for d6gnrb_:

Click to download the PDB-style file with coordinates for d6gnrb_.
(The format of our PDB-style files is described here.)

Timeline for d6gnrb_: