Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
Domain d6gfyf_: 6gfy F: [354594] Other proteins in same PDB: d6gfya_, d6gfyb1, d6gfyb2, d6gfyd_, d6gfye1, d6gfye2, d6gfyg_, d6gfyh1, d6gfyh2, d6gfyj_, d6gfyk1, d6gfyk2 automated match to d1lqbc_ complexed with exh |
PDB Entry: 6gfy (more details), 2.7 Å
SCOPe Domain Sequences for d6gfyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gfyf_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqe
Timeline for d6gfyf_: