Lineage for d1c3ja_ (1c3j A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27778Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
  4. 27779Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (4 families) (S)
  5. 27780Family c.87.1.1: beta-Glucosyltransferase (DNA-modifying) [53757] (1 protein)
  6. 27781Protein beta-Glucosyltransferase (DNA-modifying) [53758] (1 species)
  7. 27782Species Bacteriophage T4 [TaxId:10665] [53759] (6 PDB entries)
  8. 27783Domain d1c3ja_: 1c3j A: [35459]

Details for d1c3ja_

PDB Entry: 1c3j (more details), 1.88 Å

PDB Description: t4 phage beta-glucosyltransferase: substrate binding and proposed catalytic mechanism

SCOP Domain Sequences for d1c3ja_:

Sequence, based on SEQRES records: (download)

>d1c3ja_ c.87.1.1 (A:) beta-Glucosyltransferase (DNA-modifying) {Bacteriophage T4}
mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl
yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl

Sequence, based on observed residues (ATOM records): (download)

>d1c3ja_ c.87.1.1 (A:) beta-Glucosyltransferase (DNA-modifying) {Bacteriophage T4}
mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
rlivvnsnlailsaqkfmakykskiyylftdirlpfsqsaylyteeellikspikvisqg
inldiakaahkkvdnviefeyfpieqykihmndfqlskptkktldviyggsfrsgqresk
mveflfdtglnieffgnarekqfknpkypwtkapvftgkipmnmvseknsqaiaaliigd
knyndnfitlrvwetmasdavmlideefdtkhriindarfyvnnraelidrvnelkhsdv
lrkemlsiqhdilnktrakkaewqdafkkaidl

SCOP Domain Coordinates for d1c3ja_:

Click to download the PDB-style file with coordinates for d1c3ja_.
(The format of our PDB-style files is described here.)

Timeline for d1c3ja_: