Lineage for d6ew5c1 (6ew5 C:0-131)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2396500Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2396501Protein automated matches [190698] (25 species)
    not a true protein
  7. 2396530Species Human (Homo sapiens) [TaxId:9606] [187833] (50 PDB entries)
  8. 3054520Domain d6ew5c1: 6ew5 C:0-131 [354582]
    Other proteins in same PDB: d6ew5a2, d6ew5b2, d6ew5c2, d6ew5d2
    automated match to d1vyfa_
    complexed with plm; mutant

Details for d6ew5c1

PDB Entry: 6ew5 (more details), 1.95 Å

PDB Description: human myelin protein p2 f57a mutant, monoclinic crystal form
PDB Compounds: (C:) myelin p2 protein

SCOPe Domain Sequences for d6ew5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ew5c1 b.60.1.0 (C:0-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msnkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdiitirtestakn
teisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeckm
kgvvctriyekv

SCOPe Domain Coordinates for d6ew5c1:

Click to download the PDB-style file with coordinates for d6ew5c1.
(The format of our PDB-style files is described here.)

Timeline for d6ew5c1:

  • d6ew5c1 is new in SCOPe 2.07-stable