![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
![]() | Protein automated matches [190158] (31 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:1396] [354578] (1 PDB entry) |
![]() | Domain d6ft1a_: 6ft1 A: [354579] automated match to d3f6ra_ complexed with fmn, glc, so4 |
PDB Entry: 6ft1 (more details), 1.4 Å
SCOPe Domain Sequences for d6ft1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ft1a_ c.23.5.0 (A:) automated matches {Bacillus cereus [TaxId: 1396]} sklvmifasmsgnteemadhiagvireteneievidimdspeasileqydgiilgaytwg dgdlpddfldfydamdsidltgkkaavfgscdsaypkygvavdilieklqergaavvleg lkveltpededvekclqfgaefvkhls
Timeline for d6ft1a_: