Lineage for d6ft1a_ (6ft1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856900Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2856901Protein automated matches [190158] (31 species)
    not a true protein
  7. 2856906Species Bacillus cereus [TaxId:1396] [354578] (1 PDB entry)
  8. 2856907Domain d6ft1a_: 6ft1 A: [354579]
    automated match to d3f6ra_
    complexed with fmn, glc, so4

Details for d6ft1a_

PDB Entry: 6ft1 (more details), 1.4 Å

PDB Description: crystal structure of oxidised flavodoxin 1 from bacillus cereus (1.4 a resolution)
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d6ft1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ft1a_ c.23.5.0 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
sklvmifasmsgnteemadhiagvireteneievidimdspeasileqydgiilgaytwg
dgdlpddfldfydamdsidltgkkaavfgscdsaypkygvavdilieklqergaavvleg
lkveltpededvekclqfgaefvkhls

SCOPe Domain Coordinates for d6ft1a_:

Click to download the PDB-style file with coordinates for d6ft1a_.
(The format of our PDB-style files is described here.)

Timeline for d6ft1a_: