Lineage for d6g22a_ (6g22 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919888Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins)
    the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
    automatically mapped to Pfam PF06941
  6. 2919895Protein automated matches [190171] (2 species)
    not a true protein
  7. 2919896Species Human (Homo sapiens) [TaxId:9606] [186899] (19 PDB entries)
  8. 2919918Domain d6g22a_: 6g22 A: [354574]
    automated match to d1q92a_
    complexed with 2o2, bme, gol, mg

Details for d6g22a_

PDB Entry: 6g22 (more details), 1.85 Å

PDB Description: crystal structure of human mitochondrial 5'(3')-deoxyribonucleotidase in complex with the inhibitor pb-peu
PDB Compounds: (A:) 5'(3')-deoxyribonucleotidase, mitochondrial

SCOPe Domain Sequences for d6g22a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g22a_ c.108.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alrvlvdmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekais
iwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgpd
fleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlhsw
addwkaildskrp

SCOPe Domain Coordinates for d6g22a_:

Click to download the PDB-style file with coordinates for d6g22a_.
(The format of our PDB-style files is described here.)

Timeline for d6g22a_: