SCOPe 2.07: Domain d6gfzh1: 6gfz H:17-112

Lineage for d6gfzh1 (6gfz H:17-112)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Elongin C [54699] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54700] (54 PDB entries)

8. Domain d6gfzh1: 6gfz H:17-112 [354572]
   Other proteins in same PDB: d6gfza_, d6gfzb2, d6gfzc_, d6gfzd_, d6gfze2, d6gfzf_, d6gfzg_, d6gfzh2, d6gfzi_, d6gfzj_, d6gfzk2, d6gfzl_
   automated match to d1lm8c_
   complexed with exe

Details for d6gfzh1

PDB Entry: 6gfz, 2.3 Å

PDB Description: pvhl:elob:eloc in complex with modified vh032 containing (3s,4s)-3- fluoro-4-hydroxyproline (ligand 14b)

PDB Compounds: (H:) Elongin-C

SCOPe Domain Sequences for d6gfzh1:

Sequence, based on SEQRES records:

>d6gfzh1 d.42.1.1 (H:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records):

>d6gfzh1 d.42.1.1 (H:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgtnevnfreipshvlskvcmyftykvryt
nssteipefpiapeialellmaanfldc

Timeline for d6gfzh1:

• d6gfzh1 is new in SCOPe 2.07-stable
  
• d6gfzh1 appears in the current release, SCOPe 2.08