Lineage for d6g2na_ (6g2n A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527141Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins)
    the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
    automatically mapped to Pfam PF06941
  6. 2527148Protein automated matches [190171] (2 species)
    not a true protein
  7. 2527149Species Human (Homo sapiens) [TaxId:9606] [186899] (19 PDB entries)
  8. 2527159Domain d6g2na_: 6g2n A: [354564]
    automated match to d2jara_
    complexed with mg, o84

Details for d6g2na_

PDB Entry: 6g2n (more details), 1.4 Å

PDB Description: crystal structure of human cytosolic 5'(3')-deoxyribonucleotidase in complex with the inhibitor pb-pau
PDB Compounds: (A:) 5'(3')-deoxyribonucleotidase, cytosolic type

SCOPe Domain Sequences for d6g2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g2na_ c.108.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svrvlvdmdgvladfeagllrgfrrrfpeephvpleqrrgflareqyralrpdladkvas
vyeapgffldlepipgaldavremndlpdtqvfictspllkyhhcvgekyrwveqhlgpq
fveriiltrdktvvlgdlliddkdtvrgqeetpswehilftcchnrhlvlpptrrrllsw
sdnwreildskr

SCOPe Domain Coordinates for d6g2na_:

Click to download the PDB-style file with coordinates for d6g2na_.
(The format of our PDB-style files is described here.)

Timeline for d6g2na_: