Lineage for d13pkb_ (13pk B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 709735Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 709736Superfamily c.86.1: Phosphoglycerate kinase [53748] (1 family) (S)
  5. 709737Family c.86.1.1: Phosphoglycerate kinase [53749] (1 protein)
    Domain 2 binds ATP
  6. 709738Protein Phosphoglycerate kinase [53750] (7 species)
  7. 709759Species Trypanosoma brucei [TaxId:5691] [53754] (2 PDB entries)
  8. 709762Domain d13pkb_: 13pk B: [35456]

Details for d13pkb_

PDB Entry: 13pk (more details), 2.5 Å

PDB Description: ternary complex of phosphoglycerate kinase from trypanosoma brucei
PDB Compounds: (B:) 3-phosphoglycerate kinase

SCOP Domain Sequences for d13pkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d13pkb_ c.86.1.1 (B:) Phosphoglycerate kinase {Trypanosoma brucei [TaxId: 5691]}
ekksinecdlkgkkvlirvdfnvpvkngkitndyrirsalptlkkvlteggscvlmshlg
rpkgipmaqagkirstggvpgfqqkatlkpvakrlselllrpvtfapdclnaadvvskms
pgdvvllenvrfykeegskkakdreamakilasygdvyisdafgtahrdsatmtgipkil
gngaagylmekeisyfakvlgnpprplvaivggakvsdkiqlldnmlqridylliggama
ytflkaqgysigkskceesklefarsllkkaedrkvqvilpidhvchtefkavdsplite
dqnipeghmaldigpktiekyvqtigkcksaiwngpmgvfemvpyskgtfaiakamgrgt
hehglmsiigggdsasaaelsgeakrmshvstgggaslellegktlpgvtvlddk

SCOP Domain Coordinates for d13pkb_:

Click to download the PDB-style file with coordinates for d13pkb_.
(The format of our PDB-style files is described here.)

Timeline for d13pkb_: