Lineage for d6ew5a1 (6ew5 A:0-131)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805574Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2805575Protein automated matches [190698] (25 species)
    not a true protein
  7. 2805614Species Human (Homo sapiens) [TaxId:9606] [187833] (51 PDB entries)
  8. 2805668Domain d6ew5a1: 6ew5 A:0-131 [354555]
    Other proteins in same PDB: d6ew5a2, d6ew5b2, d6ew5c2, d6ew5d2
    automated match to d1vyfa_
    complexed with plm; mutant

Details for d6ew5a1

PDB Entry: 6ew5 (more details), 1.95 Å

PDB Description: human myelin protein p2 f57a mutant, monoclinic crystal form
PDB Compounds: (A:) myelin p2 protein

SCOPe Domain Sequences for d6ew5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ew5a1 b.60.1.0 (A:0-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msnkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdiitirtestakn
teisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeckm
kgvvctriyekv

SCOPe Domain Coordinates for d6ew5a1:

Click to download the PDB-style file with coordinates for d6ew5a1.
(The format of our PDB-style files is described here.)

Timeline for d6ew5a1: