Lineage for d6gfzi_ (6gfz I:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378586Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2378587Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2378588Protein VHL [49470] (1 species)
  7. 2378589Species Human (Homo sapiens) [TaxId:9606] [49471] (39 PDB entries)
  8. 2378667Domain d6gfzi_: 6gfz I: [354551]
    Other proteins in same PDB: d6gfza_, d6gfzb1, d6gfzb2, d6gfzd_, d6gfze1, d6gfze2, d6gfzg_, d6gfzh1, d6gfzh2, d6gfzj_, d6gfzk1, d6gfzk2
    automated match to d1lqbc_
    complexed with exe

Details for d6gfzi_

PDB Entry: 6gfz (more details), 2.3 Å

PDB Description: pvhl:elob:eloc in complex with modified vh032 containing (3s,4s)-3- fluoro-4-hydroxyproline (ligand 14b)
PDB Compounds: (I:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d6gfzi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gfzi_ b.3.3.1 (I:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d6gfzi_:

Click to download the PDB-style file with coordinates for d6gfzi_.
(The format of our PDB-style files is described here.)

Timeline for d6gfzi_: